DPCstruct | MC57351
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 83 ± 9 aa |
| Standard deviation of domain lengths | 8.51 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S1LD21 | 1-91 | MEGDDETMGKTEQISAWWYLSFAGESGWLGACFIRAASSSAAVKRAHAVGANPGGEVSALGPLDLDIRAEYADRLLTLAEAEDARAV… |
| A0A5C7YTW4 | 2-74 | TEDTGWWYLSFSGGDGWLGGCFVRATGIADAAKNAHEAQCNPGGEVAGWGPLDVDIKPEFTYRLLTEDEVERA |
| A0A7G1KTU4 | 7-97 | None |
| A0A3N8AQD0 | 1-87 | None |
| A0A3N5GNL9 | 11-101 | None |
| A0A522QPR7 | 19-101 | None |
| A0A1E3EDV1 | 1-67 | None |
| A0A7V8FTR2 | 119-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.