DPCstruct | MC57347
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 81 ± 6 aa |
| Standard deviation of domain lengths | 6.46 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 50.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183CTD1 | 1-73 | MRLYEFDDYLYDELPEVLDWRNVNGVNYASIDRNQHIPQYCGSCWAMGATSSLADRINIKRKNAWPSAYLSVQ |
| A0A402G3A5 | 9-84 | PHNRTYPRPHEYLDISKLPQSWDWRNVDGVNYVSTTRNQHIPQYCGSCWAHGSTSALADRINIKRKAVWPSAYLSV |
| A0A0P4WE72 | 52-137 | None |
| A0A672G9C1 | 42-113 | None |
| A0A498N921 | 16-102 | None |
| A0A7S4J1V5 | 31-117 | None |
| S4R5X7 | 151-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.