DPCstruct | MC5734
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 141 ± 12 aa |
| Standard deviation of domain lengths | 12.02 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 95.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 42.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06545 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376W1P5 | 81-220 | GANDQSVIDRLNWMRDVQGPMLRDAMKIIGEIDLRLMLAQALHMGDECHNRNNAGTTLLIQALTPGIIQAGYSVEQQREVFEFVASS… |
| A0A2X1N2A0 | 1-153 | MGANDQSVIDRLNWMRDVQGPILRDAMKIIGEIDLRLMLAQALHMGDECHNRNNAGTTLLIQALTPGIIQAGYSVEQQREVFEFVAS… |
| A0A447JLZ7 | 23-171 | None |
| A0A2V6TAC4 | 689-833 | None |
| A0A0M0K0G8 | 775-920 | None |
| A0A7X7IWT6 | 174-330 | None |
| A0A354U761 | 135-267 | None |
| A0A8B5W7B0 | 429-574 | None |
| A0A1G9AAJ4 | 208-349 | None |
| A0A2G4ACS0 | 1-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.