DPCstruct | MC57338
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 158 ± 14 aa |
| Standard deviation of domain lengths | 14.16 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 21.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V4P0K7 | 1-175 | MQPSIRDDHPLRRFLAGLAEDSFHCHLGLCDPQLIDYVVDLLIDFIHTDRLHPLRDARGRRLDQVVDMLTLSAADPDISETEHRRRV… |
| A0A6B1CK52 | 10-168 | SPSGLRSFFQRLVFPGFTSLGIADREVVEYVVDLLTSFARTDQLYRIRDLRGQPLETIAEMMVELGRQRQPERRWSFDREMDIRRHV… |
| A0A2W4L7M6 | 11-172 | None |
| A0A2E8WKL0 | 14-170 | None |
| A0A350HET9 | 35-184 | None |
| A0A2W4RG22 | 1-168 | None |
| A0A2E6MQL3 | 16-153 | None |
| A0A7J3CUF0 | 1-154 | None |
| A0A3M0YCE2 | 75-228 | None |
| A0A7T9IDU2 | 1-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.