DPCstruct | MC57335
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 250 ± 45 aa |
| Standard deviation of domain lengths | 44.71 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 22.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15882 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A212F4J9 | 1-137 | MCYQILTEGNDFGYALCHRIIILAMANIGQGCAILSDTEDEALKHNLCKMAYAEATYIAFHDYTLADLVFEIICVCALEGKAQFLRR… |
| A0A1S3ERA1 | 45-303 | ATLFLQERLPGVNLDAVVGFQVLEEQLRGVQDKWAPDPLLRPLGLRAGQLAAKLTALLRQAVVYLQQTDPTYLREFQPSLQPGFWKL… |
| A0A5J5CWP8 | 143-393 | None |
| A0A2T7PYE8 | 142-396 | None |
| R7TU96 | 31-349 | None |
| A0A811LM35 | 9-253 | None |
| A0A0X3NFY8 | 1-181 | None |
| A0A6J8DY39 | 2-278 | None |
| A0A7J7A289 | 38-301 | None |
| A0A4Z2D3I7 | 26-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.