DPCstruct | MC57334
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 100 ± 18 aa |
| Standard deviation of domain lengths | 17.70 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 90.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 43.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B1NTK6 | 6-104 | ALTSPHCQSHVEGDAEFHVSHEALLLDYESALVRTDSDTGRHYAGSGHMVWIGERPGQIDGAHINFAAHIANPVAVKGGPEASADEL… |
| A0A1B7JTR6 | 8-92 | LLLPYEEAMTRQDSSDHKWYNCSAHMVWVGERTRNIDQAHIEYLRGIENPIGIKCGPKMTGDLLIKLISKLNPNQELGKIILIVR |
| A0A6A6RY52 | 37-133 | None |
| S9QXS5 | 227-312 | None |
| G9BF71 | 171-257 | None |
| R0GS61 | 27-140 | None |
| A0A6A4NI33 | 14-109 | None |
| R1DMD6 | 19-151 | None |
| A0A841BPY6 | 16-138 | None |
| A0A7H4P3C7 | 91-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.