DPCstruct | MC57325
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 71 ± 8 aa |
| Standard deviation of domain lengths | 7.56 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 38.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V5R3P4 | 90-157 | WLQLTLEGVSRIKSNTFSMDDVFAACAPLAVDRFPDNRHVREKLRQQMQILRDLGLVLFLGSGRYERL |
| R9L7V0 | 188-253 | WLLDVLNCVNRIETDEFCLQDVYAYGEVLQEKHRNNHNVEAKIRQQLQFLRDKGFIVFLGRGHYRK |
| A0A1F6XKU9 | 87-160 | None |
| A0A4V1ZJJ9 | 2-86 | None |
| A0A2I0NGD9 | 10-67 | None |
| A0A2V9QX48 | 74-142 | None |
| W6AXB3 | 52-120 | None |
| A0A166B3H6 | 436-503 | None |
| A0A7X8U331 | 9-76 | None |
| A0A192IDW8 | 286-354 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.