DPCstruct | MC57315
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 110 ± 13 aa |
| Standard deviation of domain lengths | 12.86 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 39.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0228 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0BSM1 | 9-107 | SKFDPEAIETIRFVAARSGKPTHFFPMALATYRLLPPPETVDVVMGEKRVVAHVPVNLWFGEELDMASLAPADADKQGQREMRANAV… |
| A0A452YQR7 | 107-211 | TGEWHPAPFDASAVDNMRRLLEHSGVPGHIYPLSLLCYEIMPPPQQIEKEIGEQRVISFHGVGLSVAEEIKYGDVTAQSRNADEARG… |
| A0A811MW68 | 306-438 | None |
| A0A7J9GG44 | 1-90 | None |
| A0A7S3AKU7 | 55-157 | None |
| R1DEQ8 | 68-185 | None |
| A0A2C6KS61 | 778-891 | None |
| A0A287FIU1 | 1-114 | None |
| A0A438GC17 | 26-128 | None |
| A0A2R6X008 | 359-480 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.