DPCstruct | MC57311
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 184 ± 29 aa |
| Standard deviation of domain lengths | 28.85 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 74.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 20.73 |
| Pfam Score | 98.44 |
| Assigned Pfam label(s) | PF06703- CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8FI48 | 4-180 | IKIDKWGRQCVENALDDAAKKIMNESYGLVESFKLIDGRLALCSIAVSCSLFALLWDFLYPFPASKTVLIICVACYFILTGVISVYL… |
| A0A7S0BDC9 | 16-199 | NHEEGKEQLVVDKLVLHDTQFVKKHLDDFMMKVLKSEGYEESNLLVVTNFMVTSIAVAAAVCSHFVLKDFKTQQHLMILCIAIWMVC… |
| A0A7J6LAY2 | 410-598 | None |
| A0A0S4JMH0 | 17-271 | None |
| A0A066VK96 | 15-257 | None |
| A0A5S6Q0P2 | 13-195 | None |
| A0A6A5E006 | 25-225 | None |
| A0A4S9NPH9 | 4-178 | None |
| A0A1W0E7R1 | 3-180 | None |
| A0A3B5Q7X8 | 204-395 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.