DPCstruct | MC5731
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 54 ± 6 aa |
| Standard deviation of domain lengths | 6.11 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 41.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1HA86 | 269-317 | VDLSVEICGVKFENPFGLASAPPTTASSMIRRAFEQGWAFAVTKTFALD |
| A0A2X1MUR3 | 2-60 | LTKDLSITFCGVKFPNPFCLSSSPVGNCYEMCAKAYDTGWGGVVFKTIAFLSPTKSRRV |
| W2T5G0 | 144-201 | None |
| S0GFL3 | 1-48 | None |
| A0A0L7L0Y3 | 110-158 | None |
| A2E0R2 | 456-524 | None |
| G1UZA2 | 1-59 | None |
| X1D3D4 | 1-53 | None |
| A0A7R9HAL5 | 224-273 | None |
| A0A376PTR9 | 1-46 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.