DPCstruct | MC57309
Metacluster Properties and Pfam Annotations
| Number of structural domains | 229 |
|---|---|
| Mean domain length (aa) | 259 ± 50 aa |
| Standard deviation of domain lengths | 49.95 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 84.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 11.67 |
| Pfam Score | 60.62 |
| Assigned Pfam label(s) | PF11739- PF09898- CL0401 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A378N6Y8 | 37-270 | PVGADLQISGKFDRLKEIWEGQLSQVSIQSTEFGQFQADKAVNVKYDNKAINANISAHCWHNRKINLCFPTAFNAGVEGKVPFEIRN… |
| A0A7Y5HI41 | 40-292 | GKVALKGALPEPLSLRGLAGTAFLALDSVRTEAFELRDASVDAILQGGVLRARSVDGTVNGGKVAASGILSLDAEPGDHVLDLRAEG… |
| A0A376S2Z1 | 53-226 | None |
| A0A1Y6CJ73 | 616-963 | None |
| A0A453E941 | 424-792 | None |
| A0A453E945 | 2-198 | None |
| A0A5M8P5X4 | 49-404 | None |
| A0A538QSC6 | 7-295 | None |
| A0A521W553 | 133-376 | None |
| A0A7W1H092 | 662-963 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.