DPCstruct | MC57305
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 158 ± 16 aa |
| Standard deviation of domain lengths | 15.85 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09835 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V6I8M1 | 3-176 | KAVYRFIHQQVIVPFQKSHAPVQEVCLGTSIGLFWSLTPLVGIQMYLGLITWMLLGLIGIRFYMPISIAMIWITNPITFPFFYYIFY… |
| A0A7W0MCP2 | 14-178 | QTLHWWSNPRTLLRYVLSLDDTPHHIALGTAVGMFIGLTPTVGIQMILAIAVYYLCLPFFRFNCKAALVTVYVSNPVTMLPLYWFDY… |
| A0A2T6DMV7 | 17-192 | None |
| A0A259LVX5 | 7-171 | None |
| A0A4Q2X7R1 | 11-164 | None |
| A0A1P8WEZ6 | 3-166 | None |
| A0A7T9E7S2 | 9-154 | None |
| A0A7C9IYZ3 | 15-168 | None |
| A0A1W1EIK7 | 12-165 | None |
| M6VQC1 | 3-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.