DPCstruct | MC57301
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 183 ± 13 aa |
| Standard deviation of domain lengths | 13.35 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 30.83 |
| Pfam Score | 97.06 |
| Assigned Pfam label(s) | PF07637- PF07631 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V5UJ18 | 2-171 | KNFASRAFRRPVTDEELERLVALARQVRQKGATDREALSITLQAVLVSPHFLFRVEKDPEPDDPDGIRALDDYEIASRLSYFLWSTM… |
| A0A7C4UW17 | 555-731 | DAEPSQLAAVLELASLAYRRPLSAAEAGQLRELYAELRRQEASHDEAIRLTLARVFVSPAFLYRMEKPPAGTEPGPLGDWELASRLS… |
| A0A2T6FJM5 | 297-478 | None |
| A0A7C7WTL1 | 96-303 | None |
| A0A3L7UV32 | 631-815 | None |
| B4D224 | 617-787 | None |
| B4D7Q6 | 219-393 | None |
| A0A6I5YRC3 | 119-304 | None |
| A0A4Q6FRM4 | 161-332 | None |
| A0A1P8WEV3 | 696-873 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.