DPCstruct | MC573
Metacluster Properties and Pfam Annotations
| Number of structural domains | 368 |
|---|---|
| Mean domain length (aa) | 239 ± 58 aa |
| Standard deviation of domain lengths | 58.23 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 82.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 15.85 |
| Pfam Score | 56.28 |
| Assigned Pfam label(s) | CL0137- PF00689- PF00122- CL0103- PF00690 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8CDV1 | 6-152 | RNPKRDRLVNEPLAAYSYFQIGAIQSFAGFTDYFTAMAQEGWFPLLCVGLRPQWENHHLQDLQDSYGQEWTFGQRLYQQYTCYTVFF… |
| A0A819I118 | 31-276 | GRLLSDNLKKVAVYLLPGGSWSQIWPVFFYLWFGVPLALSAFLATVFCMLNDVFMSLAMITEKPERDIMSRPPLIRSKDHLLNWKLL… |
| A0A1Y2HCR9 | 923-1153 | None |
| A0A6I9YMN3 | 400-626 | None |
| A0A6A6LLM8 | 333-618 | None |
| A0A6P8HIS4 | 600-853 | None |
| A0A099P7B2 | 1-179 | None |
| A0A7C6SBJ9 | 2-228 | None |
| A0A5B7DE00 | 225-570 | None |
| A0A7R9L1U6 | 438-787 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.