DPCstruct | MC57294
Metacluster Properties and Pfam Annotations
| Number of structural domains | 194 |
|---|---|
| Mean domain length (aa) | 214 ± 33 aa |
| Standard deviation of domain lengths | 33.08 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 16.96 |
| Pfam Score | 99.12 |
| Assigned Pfam label(s) | PF20231- PF10343 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815UNQ3 | 10-228 | PCVNLLIAVRSGNYKARNASWSRMVPLFFAHNRRKYAKLGARNLADLQTMPQQLSHHLEKSFVVKRTDRPFSSIPVDQALECSINRL… |
| A0A4Y2SW76 | 1-134 | MVEMMLLFQRATREGNWILHSLTVSIMMPWYFAYDSVNYARYLPVYWTEMVNLEERHPSIYQEFLKGHFMVQRQQKYGFDFTACDQV… |
| A0A2G8LN44 | 10-204 | None |
| A0A2G8L5S4 | 553-775 | None |
| C4A046 | 216-412 | None |
| A0A482ZVD6 | 85-362 | None |
| C3ZIW2 | 590-896 | None |
| A0A6S7H1Q0 | 127-308 | None |
| A0A4S8MLZ8 | 444-616 | None |
| A0A6S7GPC1 | 12-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.