DPCstruct | MC57293
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 271 ± 36 aa |
| Standard deviation of domain lengths | 36.00 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815T8L4 | 22-280 | VHNADVYSFDHEQFQMDVIYGKEESFDNSLVNLSYSDLGGFVGNICNKIGLKYGQQGLWMNICAEEFNHSTSSAELFLSNNVKQIFD… |
| A0A7J3D5J8 | 118-369 | PKDLVINSNVISFEYKEFQVDLIQVVKAEFQTQMNYFSYNDLGNFMGRIAKQVLGVTLGHKGLFYILREDTRVIGEILVSTDWEKIL… |
| G4TL87 | 77-345 | None |
| A0A6A6NUU3 | 1-206 | None |
| A0A2P6MY88 | 69-308 | None |
| A0A151GBJ4 | 53-313 | None |
| A0A179FG92 | 116-426 | None |
| A0A2N1LPC8 | 3-268 | None |
| A0A4R8RLD4 | 1-360 | None |
| A0A1Y2BW54 | 65-380 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.