DPCstruct | MC57291
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 59 ± 3 aa |
| Standard deviation of domain lengths | 3.01 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 91.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 61.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S2KNV5 | 20-78 | KESCFGRVVARFGRRCTYVVIGDDSDEETAARAHNFPFWRINSHSDTQALYTALEMGFL |
| A0A182P6G1 | 83-141 | KEQCFERIVTRFGRKSTYVVVGDGQDEENAAKNLNFPFWRISSHSDIRSLHTALEMGFL |
| A0A5N3W7N9 | 365-424 | None |
| A0A7J7JG68 | 906-964 | None |
| A0A3B3YS31 | 527-585 | None |
| A0A183T432 | 116-175 | None |
| A0A7J8C1K6 | 368-426 | None |
| A0A673AYM2 | 228-287 | None |
| A0A0R3U157 | 99-158 | None |
| A0A818F923 | 1-48 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.