DPCstruct | MC57290
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 158 ± 15 aa |
| Standard deviation of domain lengths | 15.16 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 29.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815R8I8 | 30-195 | LTTGCSRGDEPLTNGTLTAVHSGSFFDASTWGGLFIPGSGSTIIIPSGIIVSLNGTNQLSINVIIIIIFGRLTIVGNGGNSGFIFVY… |
| A0A815JEH9 | 78-240 | TFIAIKSGGFTSAGTFLGGVAPSSDVCSAGCAIRVAAGIMLSTADLNGVMTLSINSIYISLGATLQLGTPGSSNGFKFSSAIILHIF… |
| A0A821SFQ9 | 169-340 | None |
| A0A814SBW8 | 110-248 | None |
| A0A817YZP8 | 20-193 | None |
| A0A819UJJ6 | 118-277 | None |
| A0A814CIM1 | 187-343 | None |
| A0A814B8T9 | 40-198 | None |
| A0A813ZXJ6 | 4-159 | None |
| A0A817NY91 | 135-292 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.