DPCstruct | MC5729
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 157 ± 38 aa |
| Standard deviation of domain lengths | 37.69 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 87.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06097 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7ZH64 | 41-176 | DEPSNLELTLVDRIEHGPFPWQRVKAFKLMPVMAASSTSIEKDATTAEWYAASGDVSPVQGEFSLGYDQSYNGTLRLMPLDIAKDGS… |
| A0A2X1MF26 | 17-164 | LLVKPIAGKENPWIKSGQSVIFNESVDHGPFPLAQLKKLNLIPSMASIQTTLVNNEVSKPLFDMAKGETPFEINSRIGYSGDSSSDI… |
| A0A0A0GWQ7 | 70-181 | None |
| A0A377KF38 | 55-231 | None |
| A0A0B4XLP9 | 82-193 | None |
| A0A377DTC2 | 1-150 | None |
| A0A0A2WJ87 | 475-621 | None |
| A0A377XTT7 | 1-135 | None |
| A0A4U9WD09 | 17-166 | None |
| A0A3Q9KDQ8 | 1-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.