DPCstruct | MC5728
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 88 ± 3 aa |
| Standard deviation of domain lengths | 3.48 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 92.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 44.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X1MD48 | 1-86 | MSPVFVFLDEDEMQRLNKAHLLKPYLTSRHQEINEWNRQQGSTESVLNLRRMTNIGTFRAYLNEYLRNHPRIRKDMTLMVRQLASR |
| A0A7C1VED0 | 41-133 | RSINIDMNTVMFVDGKMAGKLKKIHLLTEYIEFRQEEISKYNEDNKIDGSILVNGRRMTNLGTFRIYVEQYLKNHPKVHQDLTMLVR… |
| A0A357NQV5 | 25-111 | None |
| A0A1Q9QWB8 | 16-102 | None |
| A0A376VL96 | 157-248 | None |
| A0A7X3TLB0 | 24-114 | None |
| A0A8B3G7A4 | 2-83 | None |
| A0A7H4N5F0 | 43-127 | None |
| I3U8N0 | 37-128 | None |
| A0A645EFL8 | 85-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.