DPCstruct | MC57276
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 95 ± 16 aa |
| Standard deviation of domain lengths | 15.55 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0318 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C2G2B3 | 4-89 | ERALMTQAGCFTCHAVHSRKIGPAFSWVAYHYRTQPGSLQHLARKVITGGTGYWAPWTYNTPMIPHPNLSMTQAEGMVRWVLKQSP |
| A0A496XUT6 | 12-104 | SGILFANSGEQLTKDNGCMECHNIMGEKLAPAFMGTAKKNIRWFGNKAKQNLIKGIKDGSKGKYGNFQHTAMPAYGHLNTDELDRIA… |
| A0A7C7ZA46 | 127-213 | None |
| A0A1G9LF58 | 641-729 | None |
| A0A7X3D4C0 | 303-389 | None |
| A0A7Y6ZJX2 | 463-549 | None |
| A0A1Q8YJJ7 | 113-200 | None |
| A0A6N9R6I0 | 10-104 | None |
| A0A7Y7LE37 | 5-87 | None |
| A0A139BWJ6 | 1-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.