DPCstruct | MC57275
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 189 ± 32 aa |
| Standard deviation of domain lengths | 31.96 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 86.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 15.15 |
| Pfam Score | 94.44 |
| Assigned Pfam label(s) | CL0023- PF09836 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A251WNM7 | 7-158 | APLAELARLEWAFTLAFDAPQGKPLTLNEMAVLPPEAWPLLQVTLAPSVQLLLCHFNTVAIWRASKDASAFPASQALSPTEVCLVWR… |
| A0A496XRC9 | 14-206 | GTKLFSELTSHFHSKDYGAFPQYLKENLPDIGTRYSFIPELSRLEYTIYTGQTHYEKFIPTLDTLRPLQIIEDSSKISLSLSPNIRL… |
| Q08YT1 | 247-488 | None |
| A0A2H0FSA7 | 449-661 | None |
| A0A4P9K8M2 | 37-272 | None |
| A0A7G8BRQ2 | 3-151 | None |
| A0A4Q6G5H4 | 346-555 | None |
| A0A5N5ZHQ9 | 290-532 | None |
| K2DGM1 | 2-169 | None |
| A0A521TTT3 | 174-385 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.