DPCstruct | MC5726
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 150 ± 12 aa |
| Standard deviation of domain lengths | 11.94 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 94.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 36.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05681 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X1LCF7 | 2-129 | FFVKVGSRFPLLGELQSILKQAVEEATVKAPLRHNAVEIFDEVNTGKNTGSGVPWVTWDIIPDNDDAEIEVYMAGGGCTLPGRSKVL… |
| A0A640KMB1 | 238-382 | LPSCQDTGTAIVLGKRGELCWTGGEDEKYLSKGVWNAYKYHNLRYSQTAALDMFKECNTGDNLPAQLDLLAVPGSDYEFLFIAKGGG… |
| A0A654HEF7 | 350-498 | None |
| A0A2X3EZX5 | 2-123 | None |
| A0A350M0A9 | 63-192 | None |
| A0A4R9LS92 | 60-231 | None |
| A0A800C9S1 | 4-164 | None |
| A0A1J1H7C8 | 174-344 | None |
| A0A2X3CR52 | 3-156 | None |
| A0A388NRQ0 | 101-252 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.