DPCstruct | MC57255
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 154 ± 24 aa |
| Standard deviation of domain lengths | 23.78 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 26.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y5X3C6 | 2-134 | VLGAVTEPYTGAAGTIRGVPGAGLPWIIGDAEADLRSDGRLEINVEGLVLANRAPVPPARQGTNPLPQFKAIVSCQSTVAGAPAVVN… |
| A0A521S4M6 | 20-149 | ATVATASAGGRKVLDSTMAGLPVPSTVLNGLTGGGAPWQIENGRVLLFADGRLHVEVEGLIIPAQGRNPVPQGKAVVTCGETVAAET… |
| A0A1H3P2R5 | 24-206 | None |
| A0A535EV96 | 8-167 | None |
| A0A2V9DLW4 | 13-169 | None |
| A0A1F7P513 | 5-157 | None |
| A0A7Y3K9R7 | 11-172 | None |
| A0A0S8CT28 | 3-143 | None |
| A0A7W5U7W9 | 6-193 | None |
| A0A2N8M7Q9 | 62-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.