DPCstruct | MC5725
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 167 ± 42 aa |
| Standard deviation of domain lengths | 41.86 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 84.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 33.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0064 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A5GEV4 | 118-350 | FFDPMSGLLGLSTMAIVAAMTNSNGGMYAALTGEYGNRSDVGAVAILSLNDGPFFTMLALGMMGTSFPFIAFLSVLLPIGLGMLLGN… |
| A0A2X1KVB4 | 24-164 | LPFLVGFALGNLDPELREFFSKAVQTLIPFFAFALGNTIDLTVIAQTGLLGILLGVAVIIVTGIPLIIADKLIGGGDGTAGIAASSS… |
| I3VSL6 | 1-104 | None |
| A0A6D0LYL1 | 3-184 | None |
| A0A3S4I5V9 | 2-139 | None |
| A0A7E4SF04 | 441-671 | None |
| A0A7W8SLJ6 | 39-211 | None |
| A0A5Q3Q144 | 13-183 | None |
| A0A377XQN1 | 23-231 | None |
| A0A3D0CKY9 | 2-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.