DPCstruct | MC57246
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 385 ± 74 aa |
| Standard deviation of domain lengths | 74.06 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 71.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.09 |
| Pfam Score | 82.15 |
| Assigned Pfam label(s) | PF02671- PF08295 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B6A3P5 | 77-495 | VEGNGIVDADVEAVVVNPLLQKPIDFLSGLKACPNMSDDHYAAFLKIMQDYFRDRTMTPRKVYKKVRRCMRDCPELLEEFVDNFLPA… |
| A0A183DYV7 | 1-311 | MRRIFSDYATSRKLGPSYRALPDSYEKPLCSGRTPLCDSVLNDRWVSFPSWSSEESSCVLPKKTEFEEFMFRTDDERYELDIIIEIN… |
| A0A0V1BK92 | 42-373 | None |
| A0A0C2MR01 | 81-497 | None |
| A0A6S8VHN3 | 19-523 | None |
| A0A6S8VSI8 | 1-324 | None |
| A0A6J3CBY4 | 7-324 | None |
| M4CWY0 | 54-295 | None |
| A0A1X0S7P1 | 172-618 | None |
| R0KLC8 | 2-303 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.