DPCstruct | MC57240
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 106 ± 11 aa |
| Standard deviation of domain lengths | 11.36 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 93.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 42.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S9XBI9 | 157-256 | ADFGAFNLANIDPQIRIFGPGSTVAQDVEPEYVAISADSSTAWVSLQENNAVAVVDLDAATVTELLALGYKNHSQPGKGLDPSDDDG… |
| A0A243VBT3 | 1-90 | DAYLNIEPEYIAVDSQSKYAYVTLQEVSAIAKVDIAKGQIVQVKGLPYKDHSLAQNAMDVSDEDGKSELRRAPVLGLLQPDGIDTYD… |
| A0A3N0V6F8 | 170-287 | None |
| A0A1Z8X1Z2 | 770-876 | None |
| A0A330MS17 | 483-597 | None |
| W4QD95 | 50-161 | None |
| A0A379Z7A9 | 277-382 | None |
| A0A7V9GGT9 | 205-309 | None |
| A0A5J4Z7D3 | 681-787 | None |
| A0A7W1W734 | 1-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.