DPCstruct | MC5724
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 73 ± 5 aa |
| Standard deviation of domain lengths | 4.71 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 95.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 53.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T0D7K2 | 57-132 | INILDNLKDTGINTIMFQVRLKGDALYKSDINPWSDVLTGIQGKDPGYDPLEFVIQEAHKRGMKVHAWLNPYRVTT |
| A0A2X1KK08 | 6-80 | DHLQRLGINTVFFQVKPDGTALWPSKILPWSDLMTGKIGENPGYDPLQFMLDEAHKRGMKVHAWFNPIAYRLIRS |
| A0A2V2GCF5 | 182-254 | None |
| A0A815LVZ2 | 2-70 | None |
| A0A644Y1T9 | 111-201 | None |
| A0A7R8XFB7 | 73-145 | None |
| A0A7R9ABX6 | 253-325 | None |
| A0A815HMK8 | 104-176 | None |
| A0A814RQY8 | 104-176 | None |
| A0A379LS80 | 41-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.