DPCstruct | MC57236
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 111 ± 15 aa |
| Standard deviation of domain lengths | 14.73 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 27.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q5AXY7 | 1-117 | MLHETDLAQRILTLFFDFVARDIGPDDRTPEILAAWVDGAAHLAVIYRSSFDPDLVLGLRRFFDADLGIDARSGAAEIQESISEPLG… |
| A0A138A0W6 | 45-150 | AETALLACLQALRDGRITEEWSVGVIDAGSRGELFYVVYRWWSVPLTLGFATEATISPLYGSPDDPATVGRDAAAFCIGEPLGTVRD… |
| A0A2W2AID2 | 2-92 | None |
| A0A0Q9QWE6 | 34-147 | None |
| A0A849BPN4 | 8-131 | None |
| A0A7R7YTA9 | 4-122 | None |
| A0A4S8NJJ4 | 30-118 | None |
| A0A511MSN6 | 43-166 | None |
| A0A413RJV5 | 1-85 | None |
| A0A1M5CG48 | 57-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.