DPCstruct | MC57234
Metacluster Properties and Pfam Annotations
| Number of structural domains | 216 |
|---|---|
| Mean domain length (aa) | 127 ± 22 aa |
| Standard deviation of domain lengths | 21.68 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.30 |
| Pfam Score | 97.51 |
| Assigned Pfam label(s) | CL0258- CL0110- CL0039- CL0040- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M7S7G7 | 5-133 | KSLTFDKIPICLDDITKLSFQAGTICSVKSVAKARKPSYEMEACFDEGKKSCGQFTRNYKEEELIGKQIIGLTNLPFVRIAGIKSEY… |
| A0A2V8DDN1 | 2-98 | RVGRIVAVEDFPAARKPAYKLRIDFGDGIGVKTSSAQATKHYTKQALLYRLVVAVVNFPPKQIGPYMSEVLTLGVPDGNGDVVLLVP… |
| A0A3A4VF21 | 6-143 | None |
| A0A509YJF5 | 3-94 | None |
| A0A7V6GNP8 | 41-147 | None |
| K8FIH1 | 189-322 | None |
| A0A7S4A4V9 | 4-109 | None |
| A0A251ZXW7 | 3-108 | None |
| A0A0D8XBY6 | 34-165 | None |
| A0A7S4P2S9 | 582-734 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.