DPCstruct | MC5723
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 92 ± 18 aa |
| Standard deviation of domain lengths | 17.83 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 96.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 49.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S4IW42 | 2-91 | TRAIEMGADVVGGIPHYENTRDKGVSSVMFLMDLAQRYGRLVDVHCDEIDDPQSRFLEVLAEEARVRGMGAQVTASHTCAMGSYDNA… |
| A0A2X1KFR3 | 3-80 | YPNGEALLEEALRLGADVVGAIPHFEFTREYGVESLHKTFALAQKYDRLIDVHCDEIDDEQSRFVETVAALAHREGMG |
| A0A6A9QPC6 | 24-101 | None |
| A0A1V1VEG0 | 38-113 | None |
| A0A258TKC6 | 147-270 | None |
| A0A6J7KME2 | 3-89 | None |
| A0A7H4NB53 | 128-203 | None |
| A0A447QXW2 | 40-160 | None |
| A0A7J3SJU0 | 2-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.