DPCstruct | MC57228
Metacluster Properties and Pfam Annotations
| Number of structural domains | 83 |
|---|---|
| Mean domain length (aa) | 115 ± 17 aa |
| Standard deviation of domain lengths | 17.28 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 19.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A191ZVX9 | 3-98 | EMLFQIDGGKEYRGFTHGQFWNGWACPFFTFEVAQELANDQNAVTTEEKLVYDEATDSFIYQVDYYPQEEWERFEATMIDGKKLYGI… |
| A0A4R4M785 | 4-116 | WAKAYVTIDGHDVFPAEVATWTSWNGAACPRFTRQVAERVVEAVTKTKQRAPYEDAEELFWDGDVIICRVPGTEGQEGYEPERIEPD… |
| A0A2S0N5R7 | 222-323 | None |
| A0A1I5XHZ9 | 5-112 | None |
| A0A1I5DZQ8 | 242-368 | None |
| D0LFF5 | 4-95 | None |
| D0LEE9 | 2-87 | None |
| A0A2W5WLE1 | 201-308 | None |
| A0A2N7IV30 | 4-125 | None |
| A0A7G6YHB5 | 176-296 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.