DPCstruct | MC57227
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 167 ± 9 aa |
| Standard deviation of domain lengths | 9.09 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 90.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 29.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R4M709 | 7-168 | QPPDENVAVELTVGLPAGVPLIGGGRDLDNYLFPVARRIGAARIHAAFDYKRAAVPSGIAISPVARESDPPDEPRLTVHTTVSGQSP… |
| A0A842N6Y3 | 141-308 | VLRFGYTGGGDLDNLCDPVFSVVVNEKGWFGGSRSNMVWWMASKGLGSTGCGVKVSPKASPEPLMGEAVFSGVYRGPIPRRAVIEPM… |
| A0A5E4KY23 | 156-334 | None |
| A0A5E4KL67 | 2-181 | None |
| A0A4Q2RLS5 | 2-149 | None |
| A0A117IF77 | 16-176 | None |
| L0IQ62 | 161-325 | None |
| A0A850PNS4 | 59-222 | None |
| A0A0F2Q963 | 42-220 | None |
| A0A1E4FA37 | 91-256 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.