DPCstruct | MC5722
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 104 ± 9 aa |
| Standard deviation of domain lengths | 8.55 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 94.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 54.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377E4C1 | 65-159 | MPQAEIDAHRTRALNPEHPVIRGTSANPDTYFQSGEATNPWYNAVYDHVEQAMNDFAVATGRQYQPFEYYGHPQAERVIILMGSAIG… |
| A0A2X1K566 | 1-95 | MPQVEIDAHRRRALNPEHPVIRGTSANPDTYFQSREATNPWYNAVYDHVEQAMNDFSAATGRQYQPFEYYGHPQAERVIILMALPLA… |
| T2JPL5 | 186-299 | None |
| A0A484ZCM8 | 65-159 | None |
| A0A377M166 | 103-197 | None |
| A0A3S4GG25 | 1-105 | None |
| K1UDP2 | 36-148 | None |
| A0A2C9KDX5 | 147-259 | None |
| A0A7H4NKC6 | 103-197 | None |
| A0A6M1CIK0 | 59-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.