DPCstruct | MC57217
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 186 ± 30 aa |
| Standard deviation of domain lengths | 30.00 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V0YFY7 | 1-179 | MGGYAQAWYSRVNWGGVIAGVAVALSIELVLSILGLIIGFSFSKIKSTGVLQDIGMVVSGWAAVSKVISLFFGGYVAARIVGSQSYS… |
| A0A4R1BHT2 | 4-147 | IGAILLGMLLSAIIGVLLISGIFGPVFATFFETATARQLSFPAGLFIFGVAFYFGGMLASYRAPHRRVLHGTLVSVASFGVSLVVNL… |
| A0A7W0GIQ0 | 4-179 | None |
| A0A098GL81 | 3-207 | None |
| A0A838HT35 | 8-180 | None |
| A0A7X3M0Y2 | 3-242 | None |
| A0A318B9V8 | 1-181 | None |
| A0A543NXE6 | 1-208 | None |
| A0A543AG41 | 45-264 | None |
| A0A845SNK2 | 1-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.