DPCstruct | MC57216
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 112 ± 7 aa |
| Standard deviation of domain lengths | 6.78 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 44.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01837 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V0V796 | 1-113 | VGIPIPVLDEDIVEKASVSDKEIYSTIIDYSITQRSKPSFGRVSYAELRSGKIEINGKKVRTAPISSYNKARKIAETLKEWIKQGKF… |
| A0A7V0TAY0 | 198-300 | GYGVTLFVGLGIPIPILDEEMARRVSISNRDIEVDIFDYSLPSRPHVGRTNYAELQSGTIEVANTKVRSNPVASLKNARRVAELLKR… |
| A0A847YW95 | 96-202 | None |
| A0A3A5HFP7 | 278-383 | None |
| A0A7V0YU84 | 1-127 | None |
| A0A1V5KSY5 | 104-224 | None |
| A0A7X7KDI4 | 270-376 | None |
| Q2JPY7 | 278-384 | None |
| A0A4Q2WRH0 | 82-196 | None |
| A0A7C0WDT3 | 169-278 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.