DPCstruct | MC57210
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 93 ± 12 aa |
| Standard deviation of domain lengths | 11.53 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 45.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0278 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7N0TWT0 | 28-125 | LGITPPELEVLDAFEDVEYERRDVELSLEDSSEKLHAYAYVWENKNDANLYGDWDFEAWKRDHLKDFAAMTKDFMKELEQPESKPRV… |
| A0A835Y0J2 | 1-76 | MELSDKELHILDVYESEEYYRASVKPVLEDGSEVEADVYVWKEEFRPMLEEAPWSYAEFLTQHSTAYFAMTVQFAE |
| A0A6D2HGP5 | 321-419 | None |
| A0A7J8XTI0 | 1-101 | None |
| A0A3L6RQC8 | 369-444 | None |
| A0A453SP27 | 1-97 | None |
| A0A1S4E5R3 | 43-124 | None |
| A0A835MKC0 | 375-477 | None |
| A0A0M0JMN6 | 23-129 | None |
| A0A5N6MNA2 | 79-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.