DPCstruct | MC57205
Metacluster Properties and Pfam Annotations
| Number of structural domains | 128 |
|---|---|
| Mean domain length (aa) | 115 ± 28 aa |
| Standard deviation of domain lengths | 27.75 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 84.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 34.99 |
| Pfam Score | 80.44 |
| Assigned Pfam label(s) | CL0369- CL0016- CL0036- PF03169 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7L7M5 | 233-351 | YHGGTNYGRTAEGPFITTTCEYDAPLDEYGLTRQPKYGHLTELHRAIKLCDKALLSTDPVVTSLGSYQQAHVFSSKKGGSVAFLVNH… |
| A0A0G4NES1 | 27-201 | TIVEFQGGGFQPWGGAGFESCAGLLNHEFERVLFKHAYAAGATVFNVYMTWGGTNWGNLGHSDGYTSYDYGAQITEERLVNREKYSE… |
| A0A6J1JT08 | 189-310 | None |
| A0A1D6PQ23 | 247-365 | None |
| A0A4S4E5R5 | 284-403 | None |
| A0A834XDX5 | 6-93 | None |
| A0A7J9MP43 | 35-158 | None |
| A0A2P5FEA0 | 2-82 | None |
| A0A6L2N8N7 | 15-131 | None |
| B9RR66 | 33-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.