DPCstruct | MC57200
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 368 ± 62 aa |
| Standard deviation of domain lengths | 62.01 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 21.47 |
| Pfam Score | 93.55 |
| Assigned Pfam label(s) | CL0023- CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7KY37 | 78-520 | TLVLVWELVISLYLYNGNVEFKNGSDPFLFRFLPLPLVPSFRMAVADGGYIILSTLVSVAVHEFGHAVAAARSCFLVMFPGALVALD… |
| A0A7J3GY11 | 2-415 | SRFRENVELRFPLIIIRTRRAAALFEALGRSRLAGAFGLGSAIALPVLAGIATFFLLTSLTLILTRPEVQQAQRELGPASYVLLPGI… |
| A0A835RJJ3 | 3-266 | None |
| A0A7J4EBZ7 | 1-404 | None |
| A0A5N6Q3M0 | 562-949 | None |
| A0A835NZ96 | 70-468 | None |
| A0A183LQJ6 | 19-377 | None |
| A0A397TT03 | 36-340 | None |
| A0A2S5BGI0 | 20-356 | None |
| A0A7R8GZ78 | 583-970 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.