DPCstruct | MC5720
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 108 ± 12 aa |
| Standard deviation of domain lengths | 11.58 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 47.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183H6Z3 | 15-120 | TASYNRTSEVPAQANDSYTCRFCTAPLRPDQLIDGLCNHEECRHLATFACQRQLSCSHICGGIRDEEICLPCMNCRKPDTNIKQDAD… |
| A0A078AQS1 | 1-129 | MCMYRWQSIVLDTCEEYKMFKTPIKCRFCKVQLTNISPQDFPAFQDLCQGLKCYELSEESCDKIHSECNHACCGFKNEQICLPCLNS… |
| A0A6A4V807 | 378-461 | None |
| A0A4W4FJ93 | 148-259 | None |
| A0A182EGB1 | 784-889 | None |
| A0A4Z2CK51 | 601-709 | None |
| A0A2J7QII2 | 266-377 | None |
| A0A0R3QZ60 | 526-629 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.