DPCstruct | MC572
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 122 ± 11 aa |
| Standard deviation of domain lengths | 11.25 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 73.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 51.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819GPF0 | 1-116 | MMPATTSDPTDKWILTIKSEIRVKLMLTNDDVKELARGAIVKKYNLTMAEYSKFWDVTPLMIDSLTAYIIGGTRLPVEGVIPYATTH… |
| A0A817M2E0 | 78-208 | PLKQDENDTKWIWAVRNEIRLKLIVSNKEIEELAREAISNKFDNDIVKNYSKYWDVAPLMIDSLMAYILRADSSPVVGVQQYHAIHP… |
| A0A820XLP1 | 1-114 | None |
| A0A814HZF7 | 202-306 | None |
| A0A815K0L1 | 97-206 | None |
| A0A815SI46 | 110-218 | None |
| A0A818CV82 | 16-135 | None |
| A0A821YGB8 | 1-134 | None |
| A0A822AVG4 | 1-136 | None |
| A0A821ZUP0 | 31-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.