DPCstruct | MC5719
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 452 ± 113 aa |
| Standard deviation of domain lengths | 113.47 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 79.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 17.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05794 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A250Y0T8 | 2-423 | ALAHEIVVNGDFRIKPVELPENSLRQRVKEIVHKAFWDCLNIQLSEDPPTYDHAIKLVGEIKETLLSFLLPGHTRLRNQITEVLDLD… |
| E4X459 | 3-393 | LAYEISVNDEFELDKEDPAEDTFQGQIKSTVERAFWDVVRDNIKNGDDEMVLPMIREIREQILTFLAPNSGTRERIKGQIDIDLIEQ… |
| A0A1V6RWC9 | 89-641 | None |
| A0A1X2I766 | 153-610 | None |
| L1JSQ6 | 224-685 | None |
| R8BAD6 | 4-460 | None |
| A0A8B6D6S0 | 57-384 | None |
| A0A0G2FTX1 | 2-436 | None |
| A0A1E3PSZ1 | 165-688 | None |
| A0A2D3VS98 | 485-936 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.