DPCstruct | MC57188
Metacluster Properties and Pfam Annotations
| Number of structural domains | 332 |
|---|---|
| Mean domain length (aa) | 208 ± 46 aa |
| Standard deviation of domain lengths | 45.90 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 87.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 18.23 |
| Pfam Score | 98.43 |
| Assigned Pfam label(s) | CL0111- CL0059- CL0010- PF00590- PF11760 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A843G8D9 | 1-115 | ISAVLSGSAVLGAPIGHDFAVISLSDLLTPWGLIEKRLALAGEGDFCICLYNPSSHKRKDYLKKACEILLKFKGEDTICGYVRNIGR… |
| A0A1P8YQ07 | 9-210 | PELLAELGPQVEVIDAAKIPYGRAMAQEAINAALIDGYKAGKFVVRLKGGDPYVFGRGFEELQACAAAGVPVTVVPGITSAIAVPSA… |
| R5TBN9 | 12-198 | None |
| A0A0B8P0R2 | 1-110 | None |
| A0A1R3L3I0 | 643-814 | None |
| D9UD63 | 5-225 | None |
| A0A3N7G1R3 | 5-133 | None |
| A0A0S7E7Q9 | 2-261 | None |
| A0A0G4HRS7 | 197-432 | None |
| A0A4R2JE99 | 14-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.