DPCstruct | MC57187
Metacluster Properties and Pfam Annotations
| Number of structural domains | 117 |
|---|---|
| Mean domain length (aa) | 107 ± 20 aa |
| Standard deviation of domain lengths | 20.13 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 28.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00545 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A1ZNT6 | 140-240 | NQKDEVALYIATYHKLPSNYMTKAEADNRISSIWTEDNKASIGGDTFYNREGLLPISLGITYTELDIDYSGSRRNAKRIVYSNDFRI… |
| A0A1P8YMI0 | 17-122 | LLTTGRDQPGSSTQAGVPAAAVATLQKIDEGTWPDSAGAPGTKGGDRFGNRERQLPTADASGRAVGYREWDVNPKQRGKPRDAQRIV… |
| A0A357HD70 | 105-208 | None |
| A0A2E1V738 | 77-184 | None |
| A0A7Y4S4W8 | 14-117 | None |
| A0A0H3I3V2 | 2-91 | None |
| A0A2N3RDH9 | 182-258 | None |
| A0A428D276 | 324-429 | None |
| A0A3B9YMJ5 | 19-119 | None |
| U2PVI2 | 236-328 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.