DPCstruct | MC57183
Metacluster Properties and Pfam Annotations
| Number of structural domains | 95 |
|---|---|
| Mean domain length (aa) | 218 ± 34 aa |
| Standard deviation of domain lengths | 33.61 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 75.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 15.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A814KZ76 | 43-254 | FQDPEESLNDFEKYFDKNESIFPAFVFSKHNFILESKGFECKMLIHKFRFSKDLFLNKYVQKDIVKVTLSKSDCFTMAKENECGQFS… |
| A0A6P8NDY9 | 41-295 | LNVTTISLNSIGDCSIQPTMTETQDIYIQLLQLSEFEFTNVRQCKVQITRIVYYCGMHFHTSAVHNGFAEYLHETTDQQCARMHQDG… |
| A0A164HJH7 | 2-188 | None |
| A0A2H2IQ90 | 126-382 | None |
| A0A813T4E9 | 28-222 | None |
| A0A813RR42 | 123-303 | None |
| Q170M5 | 417-641 | None |
| A0A6V7X1P5 | 353-637 | None |
| A0A6V7WGZ5 | 562-841 | None |
| A0A6V7WGK0 | 146-393 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.