DPCstruct | MC5718
Metacluster Properties and Pfam Annotations
| Number of structural domains | 123 |
|---|---|
| Mean domain length (aa) | 103 ± 15 aa |
| Standard deviation of domain lengths | 14.78 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 20.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15542 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I3QHM2 | 531-601 | SDPSKSLFNVDRTKLVGLLDEAWAKKGTPLPKDPGVYIIDMGRVVGTKGETRIRLVVIPGTSEVITAYPIH |
| A0A3E0K0L6 | 5-92 | VPGAPKVDAGKQGKHVLGHPDSMPGKKTQWAEGEDGVKLTQEAWVKGTVVKPDGSVKIYDFHKPIGVNGETRVKVHMDKKRNIHGYPV |
| A0A3N0V6N9 | 134-238 | None |
| A0A5C6VNX5 | 2-101 | None |
| A0A7W8QM74 | 70-166 | None |
| A0A171C7L4 | 3-87 | None |
| A0A0A8F3H0 | 179-260 | None |
| A0A1E5KX83 | 161-303 | None |
| A0A1E5KX73 | 31-136 | None |
| A0A7W1TZK8 | 395-503 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.