DPCstruct | MC57177
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 114 ± 16 aa |
| Standard deviation of domain lengths | 16.24 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y2CB05 | 42-139 | MRYNPGAANSQARYEEVDRSPIPPKMLKRVEKDVLALCRALGYDLNTVEFAVRDGIPYAIDFMNPAPDADYHSVGLDSYKWVVETVG… |
| A0A2V9R1E5 | 3-111 | YDPRLPHEQRYVKNPAPIAPQLYERMVKDSLKLCRALGYELNTVEFAVQGGVPYAIDFLNPAPDADYHSVGPENFEWVVNAVAELAI… |
| A0A661NMY3 | 3-92 | None |
| A0A535BXU1 | 46-163 | None |
| A0A7Y2GUL6 | 1-132 | None |
| A0A7V8SYI2 | 126-261 | None |
| S7VJW9 | 102-233 | None |
| A0A537LWM8 | 1-125 | None |
| A0A7W1YEJ4 | 96-215 | None |
| W0RA18 | 294-399 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.