DPCstruct | MC57173
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 99 ± 14 aa |
| Standard deviation of domain lengths | 14.42 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 89.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 20.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W2ASJ5 | 3-76 | RIRYCYKRNRGMWGLAFPHEWRIEIDPALDDQTLLDIAIHEAAHVVLPDLDEAQVDRLGRHAADLLWRMGFRRA |
| A0A259PLS4 | 5-105 | KKRPRSLRIMGRQYGVNWEKSNLLGSSAVGFCINTKLEIVVQDGMHPVEELDTLLHEIFHAIWFQMSINEHNPEEEVIVRKMAGGLT… |
| A0A2E2AYU7 | 19-158 | None |
| A0A5C7P335 | 3-101 | None |
| A0A1V5NWG9 | 6-83 | None |
| A0A4U9XN35 | 1-97 | None |
| A0A0C2H8A7 | 10-111 | None |
| A0A6M1W179 | 6-124 | None |
| A0A420ZBN2 | 1-103 | None |
| A0A6L6YHU8 | 24-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.