DPCstruct | MC5717
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 89 ± 8 aa |
| Standard deviation of domain lengths | 8.43 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15534 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N6DKL8 | 1-84 | MNENQIHHVIYGSRRSNHYWERLVPNRNWDEIDKIIRLVIQTGQDQKYKKIFKRTKRIEGEPVEVVYLQLKDGSYKLSNAWINF |
| A0A3E0K081 | 9-95 | AIGKLNSNQIKYIINGSKKSNHQWEKLVPDKNWGKIKEIIIDVMHNGADIPYKSVSSRVKMVNGQLVQVTYKKLPDGTIRISDAWVK |
| C0E858 | 74-155 | None |
| A0A6I0CB95 | 18-111 | None |
| A0A7V6QNT9 | 41-148 | None |
| A0A6N7XG97 | 155-240 | None |
| A0A6N7XX96 | 148-238 | None |
| R1CQK4 | 2-72 | None |
| A0A165X389 | 1-93 | None |
| A0A2W1QTT4 | 154-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.