DPCstruct | MC57157
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 100 ± 18 aa |
| Standard deviation of domain lengths | 17.54 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 74.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 36.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182IAF4 | 14-99 | LPIVPPSSPYSSTAIDGPVANRRLLPASADRLPPDGRDLLHRLLEPDPRARLRSLLQLQRIALYQHYRWEDVRTRKIVPRDLFDDE |
| A0A195EWB0 | 116-181 | APDELDRANVPGILSTNADISPAARDLLKRLLQPDPRLRLRTLLSLQRIAFYMGYNIQSYMLKKES |
| A0A821WXV7 | 21-139 | None |
| A0A482X455 | 49-169 | None |
| A0A6J1P4K2 | 3-120 | None |
| B0WZB9 | 1-106 | None |
| A0A034W5U6 | 37-149 | None |
| A0A0M8ZUD7 | 85-169 | None |
| B0WN40 | 19-114 | None |
| A0A2H1WJI2 | 44-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.